![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
![]() | Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) ![]() |
![]() | Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 protein domains) |
![]() | Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [160599] (6 PDB entries) Uniprot Q9UXC0 192-275 |
![]() | Domain d2c39i2: 2c39 I:192-275 [146339] Other proteins in same PDB: d2c39a1, d2c39b1, d2c39b2, d2c39c1, d2c39d1, d2c39d2, d2c39e1, d2c39f1, d2c39f2, d2c39g1, d2c39i1, d2c39j1, d2c39j2, d2c39k1, d2c39l1, d2c39l2, d2c39m1, d2c39n1, d2c39n2, d2c39o1, d2c39p1, d2c39p2, d2c39q1, d2c39r1, d2c39r2, d2c39s1, d2c39t1, d2c39t2, d2c39u1, d2c39v1, d2c39v2, d2c39w1, d2c39x1, d2c39x2 automatically matched to 2JE6 A:192-275 protein/RNA complex; complexed with adp |
PDB Entry: 2c39 (more details), 3.3 Å
SCOPe Domain Sequences for d2c39i2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c39i2 d.101.1.1 (I:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]} plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi dqaentarstavklleelkkhlgi
Timeline for d2c39i2:
![]() Domains from other chains: (mouse over for more information) d2c39a1, d2c39a2, d2c39b1, d2c39b2, d2c39c1, d2c39c2, d2c39d1, d2c39d2, d2c39e1, d2c39e2, d2c39f1, d2c39f2, d2c39g1, d2c39g2, d2c39j1, d2c39j2, d2c39k1, d2c39k2, d2c39l1, d2c39l2, d2c39m1, d2c39m2, d2c39n1, d2c39n2, d2c39o1, d2c39o2, d2c39p1, d2c39p2, d2c39q1, d2c39q2, d2c39r1, d2c39r2, d2c39s1, d2c39s2, d2c39t1, d2c39t2, d2c39u1, d2c39u2, d2c39v1, d2c39v2, d2c39w1, d2c39w2, d2c39x1, d2c39x2 |