PDB entry 2c39

View 2c39 on RCSB PDB site
Description: RNAse ph core of the archaeal exosome in complex with ADP
Class: hydrolase
Keywords: exosome, RNAse ph, rrp41, rrp42, phosphorolytic, exoribonuclease, RNA degradation, archaeal, hydrolase, exonuclease, nuclease
Deposited on 2005-10-05, released 2005-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.275
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39a1, d2c39a2
  • Chain 'B':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39b1, d2c39b2
  • Chain 'C':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39c1, d2c39c2
  • Chain 'D':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39d1, d2c39d2
  • Chain 'E':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39e1, d2c39e2
  • Chain 'F':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39f1, d2c39f2
  • Chain 'G':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39g1, d2c39g2
  • Chain 'H':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39i1, d2c39i2
  • Chain 'J':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39j1, d2c39j2
  • Chain 'K':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39k1, d2c39k2
  • Chain 'L':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39l1, d2c39l2
  • Chain 'M':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39m1, d2c39m2
  • Chain 'N':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39n1, d2c39n2
  • Chain 'O':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39o1, d2c39o2
  • Chain 'P':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39p1, d2c39p2
  • Chain 'Q':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39q1, d2c39q2
  • Chain 'R':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39r1, d2c39r2
  • Chain 'S':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39s1, d2c39s2
  • Chain 'T':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39t1, d2c39t2
  • Chain 'U':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39u1, d2c39u2
  • Chain 'V':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39v1, d2c39v2
  • Chain 'W':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39w1, d2c39w2
  • Chain 'X':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c39x1, d2c39x2
  • Heterogens: ADP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c39A (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39A (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c39B (B:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39B (B:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c39C (C:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39C (C:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c39D (D:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c39E (E:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39E (E:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c39F (F:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39F (F:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2c39G (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39G (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2c39I (I:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39I (I:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2c39J (J:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39J (J:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2c39K (K:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39K (K:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2c39L (L:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39L (L:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2c39M (M:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39M (M:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2c39N (N:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39N (N:)
    pklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhprhl
    slpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidvft
    eilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgeadm
    piammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeegv
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2c39O (O:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39O (O:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c39P (P:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2c39Q (Q:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39Q (Q:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c39R (R:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2c39S (S:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39S (S:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlg
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c39T (T:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2c39U (U:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39U (U:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykvvnknevvgklplnypvvt
    isvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqaentar
    stavklleelkkhlg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2c39V (V:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39V (V:)
    rpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhprh
    lslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidvf
    teilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgead
    mpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2c39W (W:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39W (W:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveisvnknevvgklplnyp
    vvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqaen
    tarstavklleelkkhlgi
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2c39X (X:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c39X (X:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgdgviildlnetedmwgeadm
    piammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeegv