Lineage for d2c39b2 (2c39 B:156-248)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967341Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2967342Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2967343Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2967344Protein Exosome complex exonuclease 1, ECX1 [160590] (2 species)
  7. 2967352Species Sulfolobus solfataricus [TaxId:2287] [160591] (9 PDB entries)
    Uniprot Q9UXC2 156-241! Uniprot Q9UXC2 156-248
  8. 2967394Domain d2c39b2: 2c39 B:156-248 [146327]
    Other proteins in same PDB: d2c39a1, d2c39a2, d2c39b1, d2c39c1, d2c39c2, d2c39d1, d2c39e1, d2c39e2, d2c39f1, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39k1, d2c39k2, d2c39l1, d2c39m1, d2c39m2, d2c39n1, d2c39o1, d2c39o2, d2c39p1, d2c39q1, d2c39q2, d2c39r1, d2c39s1, d2c39s2, d2c39t1, d2c39u1, d2c39u2, d2c39v1, d2c39w1, d2c39w2, d2c39x1
    automatically matched to 2BR2 B:156-248
    protein/RNA complex; complexed with adp

Details for d2c39b2

PDB Entry: 2c39 (more details), 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp
PDB Compounds: (B:) probable exosome complex exonuclease 1

SCOPe Domain Sequences for d2c39b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c39b2 d.101.1.1 (B:156-248) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]}
pmrdliagvavgkadgviildlnetedmwgeadmpiammpslnqvtlfqlngsmtpdefr
qafdlavkginiiynlerealkskyvefkeegv

SCOPe Domain Coordinates for d2c39b2:

Click to download the PDB-style file with coordinates for d2c39b2.
(The format of our PDB-style files is described here.)

Timeline for d2c39b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c39b1
View in 3D
Domains from other chains:
(mouse over for more information)
d2c39a1, d2c39a2, d2c39c1, d2c39c2, d2c39d1, d2c39d2, d2c39e1, d2c39e2, d2c39f1, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39j2, d2c39k1, d2c39k2, d2c39l1, d2c39l2, d2c39m1, d2c39m2, d2c39n1, d2c39n2, d2c39o1, d2c39o2, d2c39p1, d2c39p2, d2c39q1, d2c39q2, d2c39r1, d2c39r2, d2c39s1, d2c39s2, d2c39t1, d2c39t2, d2c39u1, d2c39u2, d2c39v1, d2c39v2, d2c39w1, d2c39w2, d2c39x1, d2c39x2