Lineage for d2c39u2 (2c39 U:192-274)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967341Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134
  4. 2967342Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) (S)
  5. 2967343Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)
  6. 2967405Protein Exosome complex exonuclease 2, ECX2 [160597] (2 species)
  7. 2967419Species Sulfolobus solfataricus [TaxId:2287] [160599] (6 PDB entries)
    Uniprot Q9UXC0 192-275
  8. 2967435Domain d2c39u2: 2c39 U:192-274 [146363]
    Other proteins in same PDB: d2c39a1, d2c39b1, d2c39b2, d2c39c1, d2c39d1, d2c39d2, d2c39e1, d2c39f1, d2c39f2, d2c39g1, d2c39i1, d2c39j1, d2c39j2, d2c39k1, d2c39l1, d2c39l2, d2c39m1, d2c39n1, d2c39n2, d2c39o1, d2c39p1, d2c39p2, d2c39q1, d2c39r1, d2c39r2, d2c39s1, d2c39t1, d2c39t2, d2c39u1, d2c39v1, d2c39v2, d2c39w1, d2c39x1, d2c39x2
    automatically matched to 2JE6 A:192-275
    protein/RNA complex; complexed with adp

Details for d2c39u2

PDB Entry: 2c39 (more details), 3.3 Å

PDB Description: rnase ph core of the archaeal exosome in complex with adp
PDB Compounds: (U:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2c39u2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c39u2 d.101.1.1 (U:192-274) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]}
plnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdi
dqaentarstavklleelkkhlg

SCOPe Domain Coordinates for d2c39u2:

Click to download the PDB-style file with coordinates for d2c39u2.
(The format of our PDB-style files is described here.)

Timeline for d2c39u2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c39u1
View in 3D
Domains from other chains:
(mouse over for more information)
d2c39a1, d2c39a2, d2c39b1, d2c39b2, d2c39c1, d2c39c2, d2c39d1, d2c39d2, d2c39e1, d2c39e2, d2c39f1, d2c39f2, d2c39g1, d2c39g2, d2c39i1, d2c39i2, d2c39j1, d2c39j2, d2c39k1, d2c39k2, d2c39l1, d2c39l2, d2c39m1, d2c39m2, d2c39n1, d2c39n2, d2c39o1, d2c39o2, d2c39p1, d2c39p2, d2c39q1, d2c39q2, d2c39r1, d2c39r2, d2c39s1, d2c39s2, d2c39t1, d2c39t2, d2c39v1, d2c39v2, d2c39w1, d2c39w2, d2c39x1, d2c39x2