Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.4: Translational machinery components [53137] (3 families) |
Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
Protein Ribosomal protein L18 (L18p) [53139] (5 species) |
Species Escherichia coli [TaxId:562] [159642] (29 PDB entries) Uniprot P0C018 1-117 |
Domain d2gycm1: 2gyc M:3-115 [145271] Other proteins in same PDB: d2gyc11, d2gyc31, d2gyc32, d2gyc51, d2gyc52, d2gycb1, d2gycc1, d2gycd1, d2gycf1, d2gycf2, d2gycg1, d2gycg2, d2gych1, d2gyci1, d2gycj1, d2gyck1, d2gycn1, d2gyco1, d2gycq1, d2gycs1, d2gyct1, d2gycu1, d2gycw1, d2gycx1 protein/RNA complex protein/RNA complex has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2gyc (more details), 15 Å
SCOPe Domain Sequences for d2gycm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gycm1 c.55.4.1 (M:3-115) Ribosomal protein L18 (L18p) {Escherichia coli [TaxId: 562]} kksarirratrarrklqelgatrlvvhrtprhiyaqviapngsevlvaastvekaiaeql kytgnkdaaaavgkavaeralekgikdvsfdrsgfqyhgrvqaladaareagl
Timeline for d2gycm1: