Lineage for d2gycg2 (2gyc G:2-72)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946680Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2946681Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2946682Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2946686Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2946692Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2946719Domain d2gycg2: 2gyc G:2-72 [145268]
    Other proteins in same PDB: d2gyc11, d2gyc31, d2gyc32, d2gyc51, d2gyc52, d2gycb1, d2gycc1, d2gycd1, d2gycf1, d2gycf2, d2gycg1, d2gych1, d2gyci1, d2gycj1, d2gyck1, d2gycm1, d2gycn1, d2gyco1, d2gycq1, d2gycs1, d2gyct1, d2gycu1, d2gycw1, d2gycx1
    protein/RNA complex
    protein/RNA complex

Details for d2gycg2

PDB Entry: 2gyc (more details), 15 Å

PDB Description: Structure of the 50S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (G:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2gycg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gycg2 d.47.1.1 (G:2-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
kkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitvy
adrsftfvtkt

SCOPe Domain Coordinates for d2gycg2:

Click to download the PDB-style file with coordinates for d2gycg2.
(The format of our PDB-style files is described here.)

Timeline for d2gycg2: