Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein) Pfam PF01245 |
Protein Ribosomal protein L19 [141246] (3 species) |
Species Escherichia coli [TaxId:562] [141247] (9 PDB entries) Uniprot P0A7K6 1-114 |
Domain d2gycn1: 2gyc N:1-114 [135852] Other proteins in same PDB: d2gyc11, d2gyc31, d2gyc32, d2gyc51, d2gyc52, d2gycb1, d2gycc1, d2gycd1, d2gycf1, d2gycf2, d2gycg1, d2gycg2, d2gych1, d2gyci1, d2gycj1, d2gyck1, d2gycm1, d2gyco1, d2gycq1, d2gycs1, d2gyct1, d2gycu1, d2gycw1, d2gycx1 protein/RNA complex protein/RNA complex |
PDB Entry: 2gyc (more details), 15 Å
SCOPe Domain Sequences for d2gycn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gycn1 b.34.5.6 (N:1-114) Ribosomal protein L19 {Escherichia coli [TaxId: 562]} sniikqleqeqmkqdvpsfrpgdtvevkvwvvegskkrlqafegvviairnrglhsaftv rkisngegvervfqthspvvdsisvkrrgavrkaklyylrertgkaarikerln
Timeline for d2gycn1: