Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (7 families) |
Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) automatically mapped to Pfam PF00297 |
Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
Species Escherichia coli [TaxId:562] [159159] (29 PDB entries) Uniprot P60438 1-209 |
Domain d2gycb1: 2gyc B:1-209 [145262] Other proteins in same PDB: d2gyc11, d2gyc31, d2gyc32, d2gyc51, d2gyc52, d2gycc1, d2gycd1, d2gycf1, d2gycf2, d2gycg1, d2gycg2, d2gych1, d2gyci1, d2gycj1, d2gyck1, d2gycm1, d2gycn1, d2gyco1, d2gycq1, d2gycs1, d2gyct1, d2gycu1, d2gycw1, d2gycx1 protein/RNA complex protein/RNA complex |
PDB Entry: 2gyc (more details), 15 Å
SCOPe Domain Sequences for d2gycb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gycb1 b.43.3.2 (B:1-209) Ribosomal protein L3 {Escherichia coli [TaxId: 562]} miglvgkkvgmtriftedgvsipvtvieveanrvtqvkdlandgyraiqvttgakkanrv tkpeaghfakagveagrglwefrlaegeeftvgqsisvelfadvkkvdvtgtskgkgfag tvkrwnfrtqdathgnslshrvpgsigqnqtpgkvfkgkkmagqmgnervtvqsldvvrv daernlllvkgavpgatgsdlivkpavka
Timeline for d2gycb1: