Lineage for d2gycf2 (2gyc F:1-58)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2532193Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2532194Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2532195Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2532196Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2532204Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 2532231Domain d2gycf2: 2gyc F:1-58 [145266]
    Other proteins in same PDB: d2gyc11, d2gyc31, d2gyc32, d2gyc51, d2gyc52, d2gycb1, d2gycc1, d2gycd1, d2gycf1, d2gycg1, d2gycg2, d2gych1, d2gyci1, d2gycj1, d2gyck1, d2gycm1, d2gycn1, d2gyco1, d2gycq1, d2gycs1, d2gyct1, d2gycu1, d2gycw1, d2gycx1
    protein/RNA complex
    protein/RNA complex

Details for d2gycf2

PDB Entry: 2gyc (more details), 15 Å

PDB Description: Structure of the 50S subunit of a SecM-stalled E. coli ribosome complex obtained by fitting atomic models for RNA and protein components into cryo-EM map EMD-1143
PDB Compounds: (F:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2gycf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gycf2 d.100.1.1 (F:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d2gycf2:

Click to download the PDB-style file with coordinates for d2gycf2.
(The format of our PDB-style files is described here.)

Timeline for d2gycf2: