![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family) ![]() automatically mapped to Pfam PF08997 |
![]() | Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (2 proteins) |
![]() | Protein automated matches [190648] (1 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187726] (5 PDB entries) |
![]() | Domain d2fyuk_: 2fyu K: [145179] Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_ automated match to d1sqqk1 complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOPe Domain Sequences for d2fyuk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyuk_ f.23.15.1 (K:) automated matches {Cow (Bos taurus) [TaxId: 9913]} mltrflgpryrqlarnwvptaslwgavgavglvwatdwrlildwvpyingkfk
Timeline for d2fyuk_: