| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
| Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
| Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
| Species Cow (Bos taurus) [TaxId:9913] [81638] (19 PDB entries) Uniprot P00157 |
| Domain d2fyuc2: 2fyu C:2-260 [134397] Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_, d2fyuk_ automated match to d1ntmc2 complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOPe Domain Sequences for d2fyuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyuc2 f.21.1.2 (C:2-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
lvlfapdllgdpdnytpan
Timeline for d2fyuc2: