SCOPe 2.08: Domain d2fyue1: 2fyu E:1-69

Lineage for d2fyue1 (2fyu E:1-69)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81497] (19 PDB entries)
   Uniprot P13272; precursor of chains I,E and V,R

8. Domain d2fyue1: 2fyu E:1-69 [197933]
   Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_, d2fyuk_
   automated match to d1ntme2
   complexed with fdn, fes, hem

Details for d2fyue1

PDB Entry: 2fyu, 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor

PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d2fyue1:

Sequence; same for both SEQRES and ATOM records:

>d2fyue1 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]}
shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
smsasadvl

Timeline for d2fyue1:

• d2fyue1 first appeared in SCOPe 2.03
  
• d2fyue1 appears in SCOPe 2.07