SCOPe 2.08: Domain d2fyuf_: 2fyu F:

Lineage for d2fyuf_ (2fyu F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein automated matches [190325] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [192447] (4 PDB entries)

8. Domain d2fyuf_: 2fyu F: [134400]
   Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_, d2fyuk_
   automated match to d1qcrf_
   complexed with fdn, fes, hem

Details for d2fyuf_

PDB Entry: 2fyu, 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor

PDB Compounds: (F:) Hypothetical protein LOC616871

SCOPe Domain Sequences for d2fyuf_:

Sequence; same for both SEQRES and ATOM records:

>d2fyuf_ f.27.1.1 (F:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
avsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikr
aldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d2fyuf_:

• d2fyuf_ first appeared in SCOP 1.73, called d2fyuf1
  
• d2fyuf_ appears in SCOPe 2.07