SCOP 1.75: Domain d1vsaf2: 1vsa F:83-171

Lineage for d1vsaf2 (1vsa F:83-171)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Thermus thermophilus [TaxId:274] [160797] (11 PDB entries)
   Uniprot Q72I19 11-81! Uniprot Q72I19 82-170

8. Domain d1vsaf2: 1vsa F:83-171 [144520]
   Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
   automatically matched to 2J01 H:83-171

Details for d1vsaf2

PDB Entry: 1vsa, 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8

PDB Compounds: (F:) 50S ribosomal protein L6

SCOP Domain Sequences for d1vsaf2:

Sequence; same for both SEQRES and ATOM records:

>d1vsaf2 d.141.1.1 (F:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvrl

Timeline for d1vsaf2:

• d1vsaf2 is new in SCOP 1.75
  
• d1vsaf2 appears in SCOPe 2.01
  
• d1vsaf2 appears in the current release, SCOPe 2.08