SCOP 1.75: Domain d1vsaw1: 1vsa W:12-62

Lineage for d1vsaw1 (1vsa W:12-62)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Thermus thermophilus [TaxId:274] [140100] (6 PDB entries)
   Uniprot Q5SHP6 12-62

8. Domain d1vsaw1: 1vsa W:12-62 [120519]
   Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsax1, d1vsaz1
   automatically matched to 2J01 2:12-62

Details for d1vsaw1

PDB Entry: 1vsa, 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8

PDB Compounds: (W:) 50S ribosomal protein L29

SCOP Domain Sequences for d1vsaw1:

Sequence; same for both SEQRES and ATOM records:

>d1vsaw1 a.2.2.1 (W:12-62) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
earklspveleklvrekkrelmelrfqasigqlsqnhkirdlkrqiarllt

Timeline for d1vsaw1:

• d1vsaw1 first appeared in SCOP 1.73
  
• d1vsaw1 appears in SCOPe 2.01
  
• d1vsaw1 appears in the current release, SCOPe 2.08