Lineage for d1vsaq1 (1vsa Q:2-110)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860696Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 860697Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 860698Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 860699Protein Ribosomal protein L22 [54845] (5 species)
  7. 860804Species Thermus thermophilus [TaxId:274] [160267] (6 PDB entries)
  8. 860808Domain d1vsaq1: 1vsa Q:2-110 [144528]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    automatically matched to d1bxea_

Details for d1vsaq1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (Q:) 50S ribosomal protein L22

SCOP Domain Sequences for d1vsaq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsaq1 d.55.1.1 (Q:2-110) Ribosomal protein L22 {Thermus thermophilus [TaxId: 274]}
eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
hdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek

SCOP Domain Coordinates for d1vsaq1:

Click to download the PDB-style file with coordinates for d1vsaq1.
(The format of our PDB-style files is described here.)

Timeline for d1vsaq1: