Lineage for d1vsal1 (1vsa L:14-118)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879673Fold d.188: Prokaryotic ribosomal protein L17 [64262] (1 superfamily)
    alpha-beta-alpha(3)-beta(2); 2 layers: alpha/beta;
  4. 879674Superfamily d.188.1: Prokaryotic ribosomal protein L17 [64263] (1 family) (S)
    some topological similarity to ribosomal protein L22
  5. 879675Family d.188.1.1: Prokaryotic ribosomal protein L17 [64264] (1 protein)
  6. 879676Protein Prokaryotic ribosomal protein L17 [64265] (4 species)
  7. 879714Species Thermus thermophilus [TaxId:274] [64266] (11 PDB entries)
  8. 879727Domain d1vsal1: 1vsa L:14-118 [144524]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    automatically matched to d1gd8a_

Details for d1vsal1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (L:) 50S ribosomal protein L17

SCOP Domain Sequences for d1vsal1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsal1 d.188.1.1 (L:14-118) Prokaryotic ribosomal protein L17 {Thermus thermophilus [TaxId: 274]}
sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve

SCOP Domain Coordinates for d1vsal1:

Click to download the PDB-style file with coordinates for d1vsal1.
(The format of our PDB-style files is described here.)

Timeline for d1vsal1: