Lineage for d1vsao1 (1vsa O:2-118)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778923Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 778938Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
  5. 778939Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 778940Protein Ribosomal protein L20 [74733] (4 species)
  7. 778984Species Thermus thermophilus [TaxId:274] [158510] (11 PDB entries)
    Uniprot P60491 1-117
  8. 778993Domain d1vsao1: 1vsa O:2-118 [144526]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    automatically matched to 2J01 U:2-118

Details for d1vsao1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (O:) 50S ribosomal protein L20

SCOP Domain Sequences for d1vsao1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsao1 a.144.2.1 (O:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgvvrrrkhkkilklakgywglrsksfrkaretlfaagnyayahrkrrkrdfrrlw
ivrinaacrqhglnystfihglkkagievdrknladlavrepqvfaelverakaaqg

SCOP Domain Coordinates for d1vsao1:

Click to download the PDB-style file with coordinates for d1vsao1.
(The format of our PDB-style files is described here.)

Timeline for d1vsao1: