![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
![]() | Fold e.24: Ribosomal protein L1 [56807] (1 superfamily) 2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1) |
![]() | Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) ![]() |
![]() | Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein) |
![]() | Protein Ribosomal protein L1 [56810] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries) |
![]() | Domain d1vsaa1: 1vsa A:6-229 [144517] Other proteins in same PDB: d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1 automatically matched to 1YL3 C:5-228 |
PDB Entry: 1vsa (more details), 3.71 Å
SCOP Domain Sequences for d1vsaa1:
Sequence, based on SEQRES records: (download)
>d1vsaa1 e.24.1.1 (A:6-229) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs
>d1vsaa1 e.24.1.1 (A:6-229) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]} kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsi efrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrsvyvtttmgps vrinphs
Timeline for d1vsaa1: