Lineage for d1vsah1 (1vsa H:25-161)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825308Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 825309Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 825310Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 825311Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 825396Species Thermus thermophilus [TaxId:274] [159473] (10 PDB entries)
    Uniprot P60488 1-139
  8. 825404Domain d1vsah1: 1vsa H:25-161 [144521]
    Other proteins in same PDB: d1vsaa1, d1vsab1, d1vsac1, d1vsaf1, d1vsaf2, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
    automatically matched to 2J01 N:1-139

Details for d1vsah1

PDB Entry: 1vsa (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8
PDB Compounds: (H:) 50S ribosomal protein L13

SCOP Domain Sequences for d1vsah1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vsah1 c.21.1.1 (H:25-161) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
ktyvpkqveprwvlidaegktlgrlatkiatllrgkhrpdwtpnvamgdfvvvvnadkir
vtgkkleqkiytrysgypgglkkiplekmlathpervlehavkgmlpkgplgrrlfkrlk
vyagpdhphqaqrpekl

SCOP Domain Coordinates for d1vsah1:

Click to download the PDB-style file with coordinates for d1vsah1.
(The format of our PDB-style files is described here.)

Timeline for d1vsah1: