SCOPe 2.08: Domain d2nvxh1: 2nvx H:2-146

Lineage for d2nvxh1 (2nvx H:2-146)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
   duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
   automatically mapped to Pfam PF03870

6. Protein RNA polymerase subunit RBP8 [50322] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries)
   Uniprot P20436

8. Domain d2nvxh1: 2nvx H:2-146 [138674]
   Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxi1, d2nvxi2, d2nvxj1, d2nvxk1, d2nvxl1
   automatically matched to d1a1d__
   protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvxh1

PDB Entry: 2nvx, 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP

PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

SCOPe Domain Sequences for d2nvxh1:

Sequence, based on SEQRES records:

>d2nvxh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records):

>d2nvxh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

Timeline for d2nvxh1:

• d2nvxh1 first appeared in SCOP 1.73
  
• d2nvxh1 appears in SCOPe 2.07