SCOPe 2.08: Domain d2nvxc1: 2nvx C:3-37,C:173-268

Lineage for d2nvxc1 (2nvx C:3-37,C:173-268)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families)
   form homo and heterodimers

5. Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)

6. Protein RPB3 [64315] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
   Uniprot P16370; part of multichain biological unit

8. Domain d2nvxc1: 2nvx C:3-37,C:173-268 [138669]
   Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxh1, d2nvxi1, d2nvxi2, d2nvxj1, d2nvxk1, d2nvxl1
   automatically matched to d1i3qc1
   protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvxc1

PDB Entry: 2nvx, 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP

PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOPe Domain Sequences for d2nvxc1:

Sequence; same for both SEQRES and ATOM records:

>d2nvxc1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

Timeline for d2nvxc1:

• d2nvxc1 first appeared in SCOP 1.73
  
• d2nvxc1 appears in SCOPe 2.07