SCOPe 2.08: Domain d2nvxf1: 2nvx F:72-155

Lineage for d2nvxf1 (2nvx F:72-155)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (2 proteins)

6. Protein RPB6 [55295] (3 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
   Uniprot P20435; part of multichain biological unit

8. Domain d2nvxf1: 2nvx F:72-155 [138673]
   Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxh1, d2nvxi1, d2nvxi2, d2nvxj1, d2nvxk1, d2nvxl1
   automatically matched to d1i3qf_
   protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvxf1

PDB Entry: 2nvx, 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d2nvxf1:

Sequence; same for both SEQRES and ATOM records:

>d2nvxf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d2nvxf1:

• d2nvxf1 first appeared in SCOP 1.73
  
• d2nvxf1 appears in SCOPe 2.07