![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
![]() | Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
![]() | Family a.143.1.2: RPB6 [55294] (1 protein) |
![]() | Protein RPB6 [55295] (2 species) essential subunit of RNA polymerases I, II and III |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (24 PDB entries) |
![]() | Domain d2nvxf1: 2nvx F:72-155 [138673] Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxh1, d2nvxi1, d2nvxi2, d2nvxj1, d2nvxk1, d2nvxl1 automatically matched to d1i3qf_ complexed with dut, mg, zn |
PDB Entry: 2nvx (more details), 3.6 Å
SCOP Domain Sequences for d2nvxf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvxf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d2nvxf1: