Lineage for d2nvxh1 (2nvx H:2-146)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668670Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
    duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
  6. 668671Protein RNA polymerase subunit RBP8 [50322] (1 species)
  7. 668672Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (25 PDB entries)
  8. 668690Domain d2nvxh1: 2nvx H:2-146 [138674]
    Other proteins in same PDB: d2nvxa1, d2nvxb1, d2nvxc1, d2nvxc2, d2nvxe1, d2nvxe2, d2nvxf1, d2nvxi1, d2nvxi2, d2nvxj1, d2nvxk1, d2nvxl1
    automatically matched to d1a1d__
    complexed with dut, mg, zn

Details for d2nvxh1

PDB Entry: 2nvx (more details), 3.6 Å

PDB Description: RNA polymerase II elongation complex in 5 mM Mg+2 with 2'-dUTP
PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

SCOP Domain Sequences for d2nvxh1:

Sequence, based on SEQRES records: (download)

>d2nvxh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records): (download)

>d2nvxh1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

SCOP Domain Coordinates for d2nvxh1:

Click to download the PDB-style file with coordinates for d2nvxh1.
(The format of our PDB-style files is described here.)

Timeline for d2nvxh1: