SCOPe 2.08: Domain d2nvqf_: 2nvq F:

Lineage for d2nvqf_ (2nvq F:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (2 proteins)

6. Protein RPB6 [55295] (3 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries)
   Uniprot P20435; part of multichain biological unit

8. Domain d2nvqf_: 2nvq F: [138640]
   Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql_
   automated match to d1twff_
   protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqf_

PDB Entry: 2nvq, 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOPe Domain Sequences for d2nvqf_:

Sequence; same for both SEQRES and ATOM records:

>d2nvqf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekki
plvirrylpdgsfedwsveelivdl

Timeline for d2nvqf_:

• d2nvqf_ first appeared in SCOP 1.73, called d2nvqf1
  
• d2nvqf_ appears in SCOPe 2.07