SCOPe 2.08: Domain d2nvqh_: 2nvq H:

Lineage for d2nvqh_ (2nvq H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
   duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
   automatically mapped to Pfam PF03870

6. Protein RNA polymerase subunit RBP8 [50322] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries)
   Uniprot P20436

8. Domain d2nvqh_: 2nvq H: [138641]
   Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqf_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql_
   automated match to d1a1d__
   protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqh_

PDB Entry: 2nvq, 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp

PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III 14.5 kDa polypeptide

SCOPe Domain Sequences for d2nvqh_:

Sequence, based on SEQRES records:

>d2nvqh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records):

>d2nvqh_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
nlkqenayllirr

Timeline for d2nvqh_:

• d2nvqh_ first appeared in SCOP 1.73, called d2nvqh1
  
• d2nvqh_ appears in SCOPe 2.07