Lineage for d2nvqe1 (2nvq E:2-143)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882964Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 2882965Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 2882966Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)
  7. 2882967Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2882979Domain d2nvqe1: 2nvq E:2-143 [138638]
    Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe2, d2nvqf_, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql_
    automated match to d1twfe1
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqe1

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2nvqe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvqe1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn

SCOPe Domain Coordinates for d2nvqe1:

Click to download the PDB-style file with coordinates for d2nvqe1.
(The format of our PDB-style files is described here.)

Timeline for d2nvqe1: