| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) ![]() |
| Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins) |
| Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries) Uniprot P20434; part of multichain biological unit |
| Domain d2nvqe1: 2nvq E:2-143 [138638] Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe2, d2nvqf_, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql_ automated match to d1twfe1 protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn |
PDB Entry: 2nvq (more details), 2.9 Å
SCOPe Domain Sequences for d2nvqe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvqe1 c.52.3.1 (E:2-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfq
anpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsam
klvpsippatietfneaalvvn
Timeline for d2nvqe1: