Lineage for d2nvqe2 (2nvq E:144-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958567Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2958568Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2958569Family d.78.1.1: RPB5 [55288] (2 proteins)
  6. 2958570Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species)
  7. 2958571Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2958583Domain d2nvqe2: 2nvq E:144-215 [138639]
    Other proteins in same PDB: d2nvqa_, d2nvqb_, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqf_, d2nvqh_, d2nvqi1, d2nvqi2, d2nvqj_, d2nvqk_, d2nvql_
    automated match to d1twfe2
    protein/DNA complex; protein/RNA complex; complexed with dut, mg, zn

Details for d2nvqe2

PDB Entry: 2nvq (more details), 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2nvqe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvqe2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d2nvqe2:

Click to download the PDB-style file with coordinates for d2nvqe2.
(The format of our PDB-style files is described here.)

Timeline for d2nvqe2: