SCOP 1.73: Domain d2nvqf1: 2nvq F:72-155

Lineage for d2nvqf1 (2nvq F:72-155)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.2: RPB6 [55294] (1 protein)

6. Protein RPB6 [55295] (2 species)
   essential subunit of RNA polymerases I, II and III

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (24 PDB entries)

8. Domain d2nvqf1: 2nvq F:72-155 [138640]
   Other proteins in same PDB: d2nvqa1, d2nvqb1, d2nvqc1, d2nvqc2, d2nvqe1, d2nvqe2, d2nvqh1, d2nvqi1, d2nvqi2, d2nvqj1, d2nvqk1, d2nvql1
   automatically matched to d1i3qf_
   complexed with dut, mg, zn

Details for d2nvqf1

PDB Entry: 2nvq, 2.9 Å

PDB Description: rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp

PDB Compounds: (F:) DNA-directed RNA polymerases I, II, and III 23 kDa polypeptide

SCOP Domain Sequences for d2nvqf1:

Sequence; same for both SEQRES and ATOM records:

>d2nvqf1 a.143.1.2 (F:72-155) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivdl

Timeline for d2nvqf1:

• d2nvqf1 is new in SCOP 1.73
  
• d2nvqf1 appears in SCOP 1.75
  
• d2nvqf1 appears in the current release, SCOPe 2.07, called d2nvqf_