Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.44: Ammonium transporter [111351] (1 superfamily) 11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix |
Superfamily f.44.1: Ammonium transporter [111352] (2 families) automatically mapped to Pfam PF00909 |
Family f.44.1.0: automated matches [227165] (1 protein) not a true family |
Protein automated matches [226873] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [255505] (14 PDB entries) |
Domain d2nuud_: 2nuu D: [138614] Other proteins in same PDB: d2nuug_, d2nuuh_, d2nuui_, d2nuuj_, d2nuuk_, d2nuul_ automated match to d2b2ha_ complexed with adp |
PDB Entry: 2nuu (more details), 2.5 Å
SCOPe Domain Sequences for d2nuud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nuud_ f.44.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]} hhhhhhavadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvc ilwvvygyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvgliv galaerirfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiagl vgayligkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvv ataaailgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglagl wgvtmlkrllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvql esiaitivwsgvvafigykladltvglrvpeeqeregldvnshgenayna
Timeline for d2nuud_: