Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins) |
Protein PII-homolog GlnK [54917] (2 species) |
Species Escherichia coli [TaxId:562] [54918] (3 PDB entries) |
Domain d2nuui_: 2nuu I: [138619] Other proteins in same PDB: d2nuua_, d2nuub_, d2nuuc_, d2nuud_, d2nuue_, d2nuuf_ automated match to d1gnka_ complexed with adp |
PDB Entry: 2nuu (more details), 2.5 Å
SCOPe Domain Sequences for d2nuui_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nuui_ d.58.5.1 (I:) PII-homolog GlnK {Escherichia coli [TaxId: 562]} mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal
Timeline for d2nuui_: