SCOPe 2.04: Domain d2nuub_: 2nuu B:

Lineage for d2nuub_ (2nuu B:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.44: Ammonium transporter [111351] (1 superfamily)
   11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix

4. Superfamily f.44.1: Ammonium transporter [111352] (2 families)
   automatically mapped to Pfam PF00909

5. Family f.44.1.0: automated matches [227165] (1 protein)
   not a true family

6. Protein automated matches [226873] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255505] (14 PDB entries)

8. Domain d2nuub_: 2nuu B: [138612]
   Other proteins in same PDB: d2nuug_, d2nuuh_, d2nuui_, d2nuuj_, d2nuuk_, d2nuul_
   automated match to d2b2ha_
   complexed with adp

Details for d2nuub_

PDB Entry: 2nuu, 2.5 Å

PDB Description: regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex

PDB Compounds: (B:) Ammonia channel

SCOPe Domain Sequences for d2nuub_:

Sequence; same for both SEQRES and ATOM records:

>d2nuub_ f.44.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
hhhhhavadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvci
lwvvygyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivg
alaerirfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglv
gayligkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvva
taaailgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglw
gvtmlkrllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqle
siaitivwsgvvafigykladltvglrvpeeqeregldvnshgenayna

Timeline for d2nuub_:

• d2nuub_ first appeared in SCOP 1.73, called d2nuub1
  
• d2nuub_ was called d2nuub1 in SCOPe 2.03
  
• d2nuub_ appears in SCOPe 2.05
  
• d2nuub_ appears in the current release, SCOPe 2.08, called d2nuub2