Lineage for d2nuuf_ (2nuu F:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699687Fold f.44: Ammonium transporter [111351] (1 superfamily)
    11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix
  4. 1699688Superfamily f.44.1: Ammonium transporter [111352] (2 families) (S)
    automatically mapped to Pfam PF00909
  5. 1699697Family f.44.1.0: automated matches [227165] (1 protein)
    not a true family
  6. 1699698Protein automated matches [226873] (4 species)
    not a true protein
  7. 1699706Species Escherichia coli [TaxId:562] [255505] (14 PDB entries)
  8. 1699724Domain d2nuuf_: 2nuu F: [138616]
    Other proteins in same PDB: d2nuug_, d2nuuh_, d2nuui_, d2nuuj_, d2nuuk_, d2nuul_
    automated match to d2b2ha_
    complexed with adp

Details for d2nuuf_

PDB Entry: 2nuu (more details), 2.5 Å

PDB Description: regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex
PDB Compounds: (F:) Ammonia channel

SCOPe Domain Sequences for d2nuuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuuf_ f.44.1.0 (F:) automated matches {Escherichia coli [TaxId: 562]}
hhhhhavadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvci
lwvvygyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivg
alaerirfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglv
gayligkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvva
taaailgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglw
gvtmlkrllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqle
siaitivwsgvvafigykladltvglrvpeeqeregldvnshgenayna

SCOPe Domain Coordinates for d2nuuf_:

Click to download the PDB-style file with coordinates for d2nuuf_.
(The format of our PDB-style files is described here.)

Timeline for d2nuuf_: