SCOPe 2.08: Domain d2nuud2: 2nuu D:3-406

Lineage for d2nuud2 (2nuu D:3-406)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.44: Ammonium transporter [111351] (1 superfamily)
   11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix

4. Superfamily f.44.1: Ammonium transporter [111352] (2 families)
   automatically mapped to Pfam PF00909

5. Family f.44.1.0: automated matches [227165] (1 protein)
   not a true family

6. Protein automated matches [226873] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255505] (14 PDB entries)

8. Domain d2nuud2: 2nuu D:3-406 [138614]
   Other proteins in same PDB: d2nuua3, d2nuub3, d2nuuc3, d2nuud3, d2nuue3, d2nuuf3, d2nuug_, d2nuuh_, d2nuui_, d2nuuj_, d2nuuk_, d2nuul_
   automated match to d2b2ha_
   complexed with adp

Details for d2nuud2

PDB Entry: 2nuu, 2.5 Å

PDB Description: regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex

PDB Compounds: (D:) Ammonia channel

SCOPe Domain Sequences for d2nuud2:

Sequence; same for both SEQRES and ATOM records:

>d2nuud2 f.44.1.0 (D:3-406) automated matches {Escherichia coli [TaxId: 562]}
avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai
lgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml
krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait
ivwsgvvafigykladltvglrvpeeqeregldvnshgenayna

Timeline for d2nuud2:

• d2nuud2 first appeared in SCOP 1.73, called d2nuud1
  
• d2nuud2 appears in SCOPe 2.07