Lineage for d2nuud1 (2nuu D:3-386)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458458Fold f.44: Ammonium transporter [111351] (1 superfamily)
    11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix
  4. 1458459Superfamily f.44.1: Ammonium transporter [111352] (2 families) (S)
    automatically mapped to Pfam PF00909
  5. 1458460Family f.44.1.1: Ammonium transporter [111353] (1 protein)
    Pfam PF00909
  6. 1458461Protein Ammonium transporter AmtB [111354] (1 species)
  7. 1458462Species Escherichia coli [TaxId:562] [111355] (10 PDB entries)
    Uniprot P37905 2-407
  8. 1458475Domain d2nuud1: 2nuu D:3-386 [138614]
    Other proteins in same PDB: d2nuug_, d2nuuh_, d2nuui_, d2nuuj_, d2nuuk_, d2nuul_
    automatically matched to d1xqea_
    complexed with adp

Details for d2nuud1

PDB Entry: 2nuu (more details), 2.5 Å

PDB Description: regulating the escherichia coli ammonia channel: the crystal structure of the amtb-glnk complex
PDB Compounds: (D:) Ammonia channel

SCOPe Domain Sequences for d2nuud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nuud1 f.44.1.1 (D:3-386) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]}
avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy
gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer
irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli
gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai
lgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml
krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait
ivwsgvvafigykladltvglrvp

SCOPe Domain Coordinates for d2nuud1:

Click to download the PDB-style file with coordinates for d2nuud1.
(The format of our PDB-style files is described here.)

Timeline for d2nuud1: