![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.44: Ammonium transporter [111351] (1 superfamily) 11 transmembrane helices; duplication: consist of 2 structural repeats of five helices each plus extra C-terminal helix |
![]() | Superfamily f.44.1: Ammonium transporter [111352] (2 families) ![]() automatically mapped to Pfam PF00909 |
![]() | Family f.44.1.1: Ammonium transporter [111353] (1 protein) Pfam PF00909 |
![]() | Protein Ammonium transporter AmtB [111354] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [111355] (10 PDB entries) Uniprot P37905 2-407 |
![]() | Domain d2nuud1: 2nuu D:3-386 [138614] Other proteins in same PDB: d2nuug_, d2nuuh_, d2nuui_, d2nuuj_, d2nuuk_, d2nuul_ automatically matched to d1xqea_ complexed with adp |
PDB Entry: 2nuu (more details), 2.5 Å
SCOPe Domain Sequences for d2nuud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nuud1 f.44.1.1 (D:3-386) Ammonium transporter AmtB {Escherichia coli [TaxId: 562]} avadkadnafmmictalvlfmtipgialfygglirgknvlsmltqvtvtfalvcilwvvy gyslafgegnnffgninwlmlknieltavmgsiyqyihvafqgsfacitvglivgalaer irfsavlifvvvwltlsyipiahmvwgggllashgaldfaggtvvhinaaiaglvgayli gkrvgfgkeafkphnlpmvftgtailyigwfgfnagsagtaneiaalafvntvvataaai lgwifgewalrgkpsllgacsgaiaglvgvtpacgyigvggaliigvvaglaglwgvtml krllrvddpcdvfgvhgvcgivgcimtgifaasslggvgfaegvtmghqllvqlesiait ivwsgvvafigykladltvglrvp
Timeline for d2nuud1: