SCOPe 2.08: Domain d2j9ua_: 2j9u A:

Lineage for d2j9ua_ (2j9u A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families)

5. Family a.24.28.1: VPS28 C-terminal domain-like [140428] (2 proteins)
   C-terminal part of Pfam PF03997

6. Protein automated matches [190730] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187898] (2 PDB entries)

8. Domain d2j9ua_: 2j9u A: [138155]
   Other proteins in same PDB: d2j9ub1, d2j9ud_
   automated match to d2g3ka1
   complexed with zn

Details for d2j9ua_

PDB Entry: 2j9u, 2 Å

PDB Description: 2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii

PDB Compounds: (A:) vacuolar protein sorting-associated protein 28

SCOPe Domain Sequences for d2j9ua_:

Sequence; same for both SEQRES and ATOM records:

>d2j9ua_ a.24.28.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
rinklsigdtltetqirellfdlelayksfyall

Timeline for d2j9ua_:

• d2j9ua_ first appeared in SCOP 1.73, called d2j9ua1
  
• d2j9ua_ appears in SCOPe 2.07