Lineage for d2j9ud_ (2j9u D:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037321Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 3037322Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 3037354Protein automated matches [190731] (1 species)
    not a true protein
  7. 3037355Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187899] (1 PDB entry)
  8. 3037356Domain d2j9ud_: 2j9u D: [145678]
    Other proteins in same PDB: d2j9ua_, d2j9ub1, d2j9uc_
    automated match to d2j9ub1
    complexed with zn

Details for d2j9ud_

PDB Entry: 2j9u (more details), 2 Å

PDB Description: 2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii
PDB Compounds: (D:) vacuolar protein sorting-associated protein 36

SCOPe Domain Sequences for d2j9ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9ud_ g.41.11.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssinc

SCOPe Domain Coordinates for d2j9ud_:

Click to download the PDB-style file with coordinates for d2j9ud_.
(The format of our PDB-style files is described here.)

Timeline for d2j9ud_: