| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.28: VPS28 C-terminal domain-like [140427] (2 families) ![]() |
| Family a.24.28.1: VPS28 C-terminal domain-like [140428] (2 proteins) C-terminal part of Pfam PF03997 |
| Protein Vacuolar protein sorting-associated protein 28, VPS28 [140429] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140430] (1 PDB entry) Uniprot Q02767 148-241 |
| Domain d2g3ka1: 2g3k A:148-241 [134562] |
PDB Entry: 2g3k (more details), 3.05 Å
SCOPe Domain Sequences for d2g3ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g3ka1 a.24.28.1 (A:148-241) Vacuolar protein sorting-associated protein 28, VPS28 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fnakyvaeatgnfitvmdalklnynakdqlhpllaellisinrvtrddfenrsklidwiv
rinklsigdtltetqirellfdlelayksfyall
Timeline for d2g3ka1: