Lineage for d2j9ub1 (2j9u B:115-161)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037321Superfamily g.41.11: Ran binding protein zinc finger-like [90209] (2 families) (S)
    contains CxxxxC-x(n)-CxxC zinc-binding site; similar to the Sec23/24 zinc finger domain
  5. 3037322Family g.41.11.1: Ran binding protein zinc finger-like [90210] (7 proteins)
  6. 3037348Protein Vacuolar protein-sorting-associated protein 36, VPS36 [161173] (1 species)
  7. 3037349Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [161174] (1 PDB entry)
    Uniprot Q06696 115-161
  8. 3037350Domain d2j9ub1: 2j9u B:115-161 [145677]
    Other proteins in same PDB: d2j9ua_, d2j9uc_, d2j9ud_
    complexed with zn

Details for d2j9ub1

PDB Entry: 2j9u (more details), 2 Å

PDB Description: 2 angstrom x-ray structure of the yeast escrt-i vps28 c-terminus in complex with the nzf-n domain from escrt-ii
PDB Compounds: (B:) vacuolar protein sorting-associated protein 36

SCOPe Domain Sequences for d2j9ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j9ub1 g.41.11.1 (B:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vstwvcpicmvsnetqgeftkdtlptpicincgvpadyeltkssinc

SCOPe Domain Coordinates for d2j9ub1:

Click to download the PDB-style file with coordinates for d2j9ub1.
(The format of our PDB-style files is described here.)

Timeline for d2j9ub1: