SCOPe 2.08: Domain d2h1lk_: 2h1l K:

Lineage for d2h1lk_ (2h1l K:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
   fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain

6. Protein Papillomavirus large T antigen helicase domain [89688] (1 species)

7. Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries)
   Uniprot P03070 265-627

8. Domain d2h1lk_: 2h1l K: [135957]
   Other proteins in same PDB: d2h1lm2, d2h1lm3, d2h1ln2, d2h1ln3, d2h1lo2, d2h1lo3, d2h1lp2, d2h1lp3, d2h1lq2, d2h1lq3, d2h1lr2, d2h1lr3, d2h1ls2, d2h1ls3, d2h1lt2, d2h1lt3, d2h1lu2, d2h1lu3, d2h1lv2, d2h1lv3, d2h1lw2, d2h1lw3, d2h1lx2, d2h1lx3
   automated match to d1svmc_
   complexed with zn
   has additional subdomain(s) that are not in the common domain

Details for d2h1lk_

PDB Entry: 2h1l, 3.16 Å

PDB Description: the structure of the oncoprotein sv40 large t antigen and p53 tumor suppressor complex

PDB Compounds: (K:) large t antigen

SCOPe Domain Sequences for d2h1lk_:

Sequence; same for both SEQRES and ATOM records:

>d2h1lk_ c.37.1.20 (K:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}
kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
ld

Timeline for d2h1lk_:

• d2h1lk_ first appeared in SCOP 1.73, called d2h1lk1
  
• d2h1lk_ appears in SCOPe 2.07