![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
![]() | Protein Papillomavirus large T antigen helicase domain [89688] (1 species) |
![]() | Species Simian virus 40 [TaxId:10633] [89689] (5 PDB entries) Uniprot P03070 265-627 |
![]() | Domain d2h1ld_: 2h1l D: [135950] Other proteins in same PDB: d2h1lm2, d2h1lm3, d2h1ln2, d2h1ln3, d2h1lo2, d2h1lo3, d2h1lp2, d2h1lp3, d2h1lq2, d2h1lq3, d2h1lr2, d2h1lr3, d2h1ls2, d2h1ls3, d2h1lt2, d2h1lt3, d2h1lu2, d2h1lu3, d2h1lv2, d2h1lv3, d2h1lw2, d2h1lw3, d2h1lx2, d2h1lx3 automated match to d1svmc_ complexed with zn has additional subdomain(s) that are not in the common domain |
PDB Entry: 2h1l (more details), 3.16 Å
SCOPe Domain Sequences for d2h1ld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1ld_ c.37.1.20 (D:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv ld
Timeline for d2h1ld_:
![]() Domains from other chains: (mouse over for more information) d2h1la_, d2h1lb_, d2h1lc_, d2h1le_, d2h1lf_, d2h1lg_, d2h1lh_, d2h1li_, d2h1lj_, d2h1lk_, d2h1ll_, d2h1lm2, d2h1lm3, d2h1ln2, d2h1ln3, d2h1lo2, d2h1lo3, d2h1lp2, d2h1lp3, d2h1lq2, d2h1lq3, d2h1lr2, d2h1lr3, d2h1ls2, d2h1ls3, d2h1lt2, d2h1lt3, d2h1lu2, d2h1lu3, d2h1lv2, d2h1lv3, d2h1lw2, d2h1lw3, d2h1lx2, d2h1lx3 |