![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.5: p53-like transcription factors [49417] (8 families) ![]() |
![]() | Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins) |
![]() | Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries) |
![]() | Domain d2h1lx2: 2h1l X:92-289 [135970] Other proteins in same PDB: d2h1la_, d2h1lb_, d2h1lc_, d2h1ld_, d2h1le_, d2h1lf_, d2h1lg_, d2h1lh_, d2h1li_, d2h1lj_, d2h1lk_, d2h1ll_, d2h1lm3, d2h1ln3, d2h1lo3, d2h1lp3, d2h1lq3, d2h1lr3, d2h1ls3, d2h1lt3, d2h1lu3, d2h1lv3, d2h1lw3, d2h1lx3 automated match to d3kmda_ complexed with zn |
PDB Entry: 2h1l (more details), 3.16 Å
SCOPe Domain Sequences for d2h1lx2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h1lx2 b.2.5.2 (X:92-289) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} plsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstp ppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrnt frhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfe vrvcacpgrdrrteeenl
Timeline for d2h1lx2:
![]() Domains from other chains: (mouse over for more information) d2h1la_, d2h1lb_, d2h1lc_, d2h1ld_, d2h1le_, d2h1lf_, d2h1lg_, d2h1lh_, d2h1li_, d2h1lj_, d2h1lk_, d2h1ll_, d2h1lm2, d2h1lm3, d2h1ln2, d2h1ln3, d2h1lo2, d2h1lo3, d2h1lp2, d2h1lp3, d2h1lq2, d2h1lq3, d2h1lr2, d2h1lr3, d2h1ls2, d2h1ls3, d2h1lt2, d2h1lt3, d2h1lu2, d2h1lu3, d2h1lv2, d2h1lv3, d2h1lw2, d2h1lw3 |