PDB entry 2h1l

View 2h1l on RCSB PDB site
Description: The Structure of the Oncoprotein SV40 Large T Antigen and p53 Tumor Suppressor Complex
Class: viral protein
Keywords: p53 Loop-3 conformation change, VIRAL PROTEIN
Deposited on 2006-05-16, released 2006-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.16 Å
R-factor: 0.261
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1la_
  • Chain 'B':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1lb_
  • Chain 'C':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1lc_
  • Chain 'D':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1ld_
  • Chain 'E':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1le_
  • Chain 'F':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1lf_
  • Chain 'G':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1lg_
  • Chain 'H':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1lh_
  • Chain 'I':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1li_
  • Chain 'J':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1lj_
  • Chain 'K':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1lk_
  • Chain 'L':
    Compound: large t antigen
    Species: Simian virus 40 [TaxId:10633]
    Gene: Gene A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2h1ll_
  • Chain 'M':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lm2, d2h1lm3
  • Chain 'N':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1ln2, d2h1ln3
  • Chain 'O':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lo2, d2h1lo3
  • Chain 'P':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lp2, d2h1lp3
  • Chain 'Q':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lq2, d2h1lq3
  • Chain 'R':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lr2, d2h1lr3
  • Chain 'S':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1ls2, d2h1ls3
  • Chain 'T':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lt2, d2h1lt3
  • Chain 'U':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lu2, d2h1lu3
  • Chain 'V':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lv2, d2h1lv3
  • Chain 'W':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lw2, d2h1lw3
  • Chain 'X':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Gene: p53
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP68 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d2h1lx2, d2h1lx3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2h1lA (A:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lA (A:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2h1lB (B:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lB (B:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2h1lC (C:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lC (C:)
    tkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyana
    aifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadi
    eewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcg
    gkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgs
    vkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclersefll
    ekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgig
    vld
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2h1lD (D:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lD (D:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2h1lE (E:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lE (E:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2h1lF (F:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lF (F:)
    tkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyana
    aifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadi
    eewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcg
    gkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgs
    vkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclersefll
    ekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgig
    vld
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2h1lG (G:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lG (G:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2h1lH (H:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lH (H:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2h1lI (I:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lI (I:)
    tkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyana
    aifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadi
    eewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcg
    gkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgs
    vkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclersefll
    ekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgig
    vld
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2h1lJ (J:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lJ (J:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2h1lK (K:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lK (K:)
    kqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyanaa
    ifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadie
    ewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcgg
    kalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgsv
    kvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclerseflle
    kriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgigv
    ld
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2h1lL (L:)
    gseeaeetkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyh
    ekhyanaaifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfg
    stgsadieewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaa
    allelcggkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnl
    rdyldgsvkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhcl
    ersefllekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkf
    nvamgigvld
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lL (L:)
    tkqvswklvteyametkcddvllllgmylefqysfemclkcikkeqpshykyhekhyana
    aifadsknqkticqqavdtvlakkrvdslqltreqmltnrfndlldrmdimfgstgsadi
    eewmagvawlhcllpkmdsvvydflkcmvynipkkrywlfkgpidsgkttlaaallelcg
    gkalnvnlpldrlnfelgvaidqflvvfedvkgtggesrdlpsgqginnldnlrdyldgs
    vkvnlekkhlnkrtqifppgivtmneysvpktlqarfvkqidfrpkdylkhclersefll
    ekriiqsgialllmliwyrpvaefaqsiqsrivewkerldkefslsvyqkmkfnvamgig
    vld
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2h1lM (M:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lM (M:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2h1lN (N:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lN (N:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2h1lO (O:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lO (O:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2h1lP (P:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lP (P:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2h1lQ (Q:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lQ (Q:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2h1lR (R:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lR (R:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2h1lS (S:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lS (S:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2h1lT (T:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lT (T:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2h1lU (U:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lU (U:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2h1lV (V:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lV (V:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2h1lW (W:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lW (W:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2h1lX (X:)
    gsplsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvds
    tpppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddr
    ntfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrns
    fevrvcacpgrdrrteeenlrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2h1lX (X:)
    splsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdst
    pppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrn
    tfrhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsf
    evrvcacpgrdrrteeenl