Lineage for d2fugj3 (2fug J:250-333)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718299Superfamily d.15.13: Nqo1 middle domain-like [142984] (1 family) (S)
    possibly evolved from 2Fe-2S ferredoxins; contains no iron-sulfur cluster
  5. 718300Family d.15.13.1: Nqo1 middle domain-like [142985] (1 protein)
    C-terminal part of Pfam PF01512
  6. 718301Protein NADH-quinone oxidoreductase chain 1, Nqo1 [142986] (1 species)
  7. 718302Species Thermus thermophilus [TaxId:274] [142987] (1 PDB entry)
  8. 718305Domain d2fugj3: 2fug J:250-333 [134149]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 1:250-333
    complexed with fes, fmn, sf4

Details for d2fugj3

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (J:) NADH-quinone oxidoreductase chain 1

SCOP Domain Sequences for d2fugj3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fugj3 d.15.13.1 (J:250-333) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]}
klyqisgpvkrpgvyelpmgttfreliyewaggplepiqaiipggsstpplpfteevldt
pmsyehlqakgsmlgtggvilipe

SCOP Domain Coordinates for d2fugj3:

Click to download the PDB-style file with coordinates for d2fugj3.
(The format of our PDB-style files is described here.)

Timeline for d2fugj3:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1