Lineage for d2fugc1 (2fug C:686-767)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672755Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 672778Superfamily b.52.2: ADC-like [50692] (3 families) (S)
  5. 672802Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
    molybdopterine enzyme
  6. 672839Protein NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain [141393] (1 species)
    topoisomer of the common fold, lacking the second psi loop
  7. 672840Species Thermus thermophilus [TaxId:274] [141394] (1 PDB entry)
  8. 672842Domain d2fugc1: 2fug C:686-767 [134138]
    Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 3:686-767
    complexed with fes, fmn, sf4

Details for d2fugc1

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (C:) NADH-quinone oxidoreductase chain 3

SCOP Domain Sequences for d2fugc1:

Sequence, based on SEQRES records: (download)

>d2fugc1 b.52.2.2 (C:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea
rvvhredvpkghlylsalgpaa

Sequence, based on observed residues (ATOM records): (download)

>d2fugc1 b.52.2.2 (C:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]}
kerkgafylrptmwkahqavgkaqeaarawahpetaraealpegaqvavetpfgrvearv
vhredvpkghlylsalgpaa

SCOP Domain Coordinates for d2fugc1:

Click to download the PDB-style file with coordinates for d2fugc1.
(The format of our PDB-style files is described here.)

Timeline for d2fugc1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1