SCOP 1.73: Domain d2fugw1: 2fug W:1-196

Lineage for d2fugw1 (2fug W:1-196)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.307: Nqo5-like [143242] (1 superfamily)
   core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel

4. Superfamily d.307.1: Nqo5-like [143243] (1 family)

5. Family d.307.1.1: Nqo5-like [143244] (1 protein)
   Globular region is covered by PfamB 121908 from N-end and then by PfamB 000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329

6. Protein NADH-quinone oxidoreductase chain 5, Nqo5 [143245] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143246] (1 PDB entry)

8. Domain d2fugw1: 2fug W:1-196 [134169]
   Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugx1, d2fugy1, d2fugz1
   automatically matched to 2FUG 5:1-196
   complexed with fes, fmn, sf4

Details for d2fugw1

PDB Entry: 2fug, 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (W:) NADH-quinone oxidoreductase chain 5

SCOP Domain Sequences for d2fugw1:

Sequence, based on SEQRES records:

>d2fugw1 d.307.1.1 (W:1-196) NADH-quinone oxidoreductase chain 5, Nqo5 {Thermus thermophilus [TaxId: 274]}
mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
ltfykggsrkgyrslw

Sequence, based on observed residues (ATOM records):

>d2fugw1 d.307.1.1 (W:1-196) NADH-quinone oxidoreductase chain 5, Nqo5 {Thermus thermophilus [TaxId: 274]}
mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdnflerevydlfgiv
feghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpgltfyk
ggsrkgyrslw

Timeline for d2fugw1:

• d2fugw1 is new in SCOP 1.73
  
• d2fugw1 appears in SCOP 1.75
  
• d2fugw1 appears in the current release, SCOPe 2.08