Lineage for d2fuga2 (2fug A:7-249)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713637Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 713638Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (1 family) (S)
  5. 713639Family c.142.1.1: Nqo1 FMN-binding domain-like [142020] (1 protein)
    N-terminal part of Pfam PF01512
  6. 713640Protein NADH-quinone oxidoreductase chain 1, Nqo1 [142021] (1 species)
  7. 713641Species Thermus thermophilus [TaxId:274] [142022] (1 PDB entry)
  8. 713643Domain d2fuga2: 2fug A:7-249 [134135]
    Other proteins in same PDB: d2fug11, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
    automatically matched to 2FUG 1:7-249
    complexed with fes, fmn, sf4

Details for d2fuga2

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus
PDB Compounds: (A:) NADH-quinone oxidoreductase chain 1

SCOP Domain Sequences for d2fuga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fuga2 c.142.1.1 (A:7-249) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]}
sgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsglrgrg
gagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmilagyair
atvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayicgeet
almnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqmgteqs
kgm

SCOP Domain Coordinates for d2fuga2:

Click to download the PDB-style file with coordinates for d2fuga2.
(The format of our PDB-style files is described here.)

Timeline for d2fuga2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1