SCOP 1.73: Domain d2fugb1: 2fug B:3-180

Lineage for d2fugb1 (2fug B:3-180)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.21: NQO2-like [142405] (1 protein)
   complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle

6. Protein NADH-quinone oxidoreductase chain 2, NQO2 [142406] (1 species)

7. Species Thermus thermophilus [TaxId:274] [142407] (1 PDB entry)

8. Domain d2fugb1: 2fug B:3-180 [134137]
   Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1
   automatically matched to 2FUG 2:3-180
   complexed with fes, fmn, sf4

Details for d2fugb1

PDB Entry: 2fug, 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (B:) NADH-quinone oxidoreductase chain 2

SCOP Domain Sequences for d2fugb1:

Sequence; same for both SEQRES and ATOM records:

>d2fugb1 c.47.1.21 (B:3-180) NADH-quinone oxidoreductase chain 2, NQO2 {Thermus thermophilus [TaxId: 274]}
ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve

Timeline for d2fugb1:

• d2fugb1 is new in SCOP 1.73
  
• d2fugb1 appears in SCOP 1.75
  
• d2fugb1 appears in the current release, SCOPe 2.08