SCOP 1.73: Domain d2fug91: 2fug 9:26-179

Lineage for d2fug91 (2fug 9:26-179)

Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (6 families)
Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (11 proteins)
members of this "family" may be more closely related to other ferredoxins than to each other
Protein NADH-quinone oxidoreductase chain 9, Nqo9 [143252] (1 species)
Species Thermus thermophilus [TaxId:274] [143253] (1 PDB entry)

Domain d2fug91: 2fug 9:26-179 [134133]
Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug71, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugz1
complexed with fes, fmn, sf4

Details for d2fug91

PDB Entry: 2fug (more details), 3.3 Å

PDB Description: crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus

PDB Compounds: (9:) NADH-quinone oxidoreductase chain 9

SCOP Domain Sequences for d2fug91:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]}
ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
qrreakrtgkpvkvgyvvpyvrpelegfkapteg

SCOP Domain Coordinates for d2fug91:

Click to download the PDB-style file with coordinates for d2fug91.
(The format of our PDB-style files is described here.)

Timeline for d2fug91: